Amylin (IAPP)(Feline)
Product Information
| Puriy | ≥95% |
| Molucular Weight | 3910 |
| Formula | C165H270N52O54S2 |
| Sequence (Short) | KCNTATCATQRLANFLIRSSNNLGAILSPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7) |
| Sequence | Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Ile-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Ala-Ile-Leu-Ser-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2（Disulfide bridge:Cys2-Cys7） |
| Description | Amylin (IAPP), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline TFA is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline TFA is a regulatory peptide, which inhibits insulin and glucagon secretion. |
| Target | Amylin Receptor |
User Instruction
REQUEST A QUOTE
